PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G002400.1.p
Common NameGLYMA_06G002400, LOC100802811
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 855aa    MW: 99006.2 Da    PI: 8.0881
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G002400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR177.42.8e-2494180191
                 FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                          +fY+eYA++vGF +++++s++sk++g++++ +  Cs+ g+++e+ +      ++r+ ++tgCka +++kk++dg+w ++++++eHnH ++
  Glyma.06G002400.1.p  94 SFYREYARSVGFGITIKASRRSKKSGKFIDIKIACSRFGSKRESGTV----VNPRPCKKTGCKAGIHIKKKQDGNWIIYNFVKEHNHGIC 179
                          5****************************************998877....9***********************************998 PP

                 FAR1  91 p 91 
                          p
  Glyma.06G002400.1.p 180 P 180
                          6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.9E-2194180IPR004330FAR1 DNA binding domain
PfamPF105512.4E-26258350IPR018289MULE transposase domain
PROSITE profilePS509669.841536574IPR007527Zinc finger, SWIM-type
SMARTSM005756.5E-8549576IPR006564Zinc finger, PMZ-type
PfamPF044342.7E-6550572IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 855 aa     Download sequence    Send to blast
MEIDLELPIC EHEMLKSGSS GNDVTDTACD IYLEEQSINP SSMTEHSKKV LSENAFCCQD  60
QVDLNSNQVD AIDKFPFKEP QNGLEFESKE AAYSFYREYA RSVGFGITIK ASRRSKKSGK  120
FIDIKIACSR FGSKRESGTV VNPRPCKKTG CKAGIHIKKK QDGNWIIYNF VKEHNHGICP  180
DDFFRGSKQT SIVASQKKGM QLALEEGDVQ SMIEYFVSMQ CKNPNFFYAI DLDQNRHLRT  240
VFWVDSKGRL DYQNFHDIVL IDTFYLRNKY KIPFVPFVGV NHHFQYILLG CALVGEETVS  300
AFIWLMRAWL KAMSNLPPKV IITDQEQFLK EAVMEVFPDK RHCFCLSHIL CKITKNLDYI  360
IDQNNNFMGK FDKCIHHSCS DEQFEKRWWK LINRFELKND EWVQSLYEDR KKWVPTFMQD  420
ISLAGLSTTV RYESISSSFD KYICVDSTFK EFIEQYKVFS IDSFDMEAKA DFETKQKQPA  480
LRSLSPFEKQ LSTIYTDAIF RKFQLEILGM MSCHLQKETE KRANVTFLVD DFEEQKKFIV  540
SWKEADLYVS CSCCLFQYKG FLCRHAILVL QKSGITNIPS HYILKRWMKD AKANQFVGDV  600
ITRTAHRVQR FNDLCRQAII LSEIGSLSED TYRVASQALE EIYKHCVNAN NFARSTLESN  660
KLVLNGFDVE EKNDGCHRAK PTKKRKSFNK RECSDPERIN IKMLDDFQKR EQRNTRAHNF  720
DNCYISQQDI QTVDLDSRAS TLDVYYGAQR NVLGDSQLNS VSVMRDCYYG SQLAILGLVG  780
RMYFFLGSFF RDLYGSHFVS IFRGNCIPCQ AVVHIMKCST ACKDRFKDCS LSERQKLWNN  840
LLGTRSSMAL HQSN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581088.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 2-like isoform X1
SwissprotQ3EBQ30.0FRS2_ARATH; Protein FAR1-RELATED SEQUENCE 2
TrEMBLA0A0R0J9K40.0A0A0R0J9K4_SOYBN; Uncharacterized protein
STRINGGLYMA06G00461.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32250.40.0FAR1-related sequence 2